peptoma-mcp
An MCP server that connects AI agents to the PEPTOMA open DeSci peptide research platform, enabling peptide sequence analysis, feed search, and peer-review annotations.
README
peptoma-mcp
Official MCP (Model Context Protocol) server for PEPTOMA — connect any AI agent to the open DeSci peptide research platform.
What This Does
peptoma-mcp runs a local MCP server that exposes PEPTOMA's full research platform as tools to any compatible AI agent — Claude Desktop, Cursor, VS Code, Zed, and any other MCP-compatible client.
Once connected, your AI agent can:
- Submit peptide sequences for AI analysis and receive bioactivity scores, structure predictions, toxicity risk, and half-life estimates
- Search and filter the open PEPTOMA research feed of thousands of analyzed sequences
- Read and write peer-review annotations to earn $PEPTM token rewards
- Query token balances, staking tiers, and the contributor leaderboard
No custom code required. Install, configure, and your agent is connected to the live PEPTOMA platform.
Requirements
- Node.js ≥ 18
- A PEPTOMA API key (
pptm_...) — available to PRO (≥ 2,000 $PEPTM staked) and LAB (≥ 10,000 $PEPTM staked) tier wallets - Generate your key at peptoma.xyz/missions
Quick Start
# Run directly with npx (no install needed)
npx peptoma-mcp --api-key pptm_your_key_here
# Or install globally
npm install -g peptoma-mcp
peptoma-mcp --api-key pptm_your_key_here
# Or use environment variable
export PEPTOMA_API_KEY=pptm_your_key_here
npx peptoma-mcp
Claude Desktop Setup
Add to ~/.claude/claude_desktop_config.json:
{
"mcpServers": {
"peptoma": {
"command": "npx",
"args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
}
}
}
Restart Claude Desktop. You will now see PEPTOMA tools available in your conversations.
Cursor Setup
Add to your Cursor MCP config (.cursor/mcp.json or global config):
{
"mcpServers": {
"peptoma": {
"command": "npx",
"args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
}
}
}
VS Code (Copilot Agent Mode)
Add to .vscode/mcp.json in your project:
{
"servers": {
"peptoma": {
"type": "stdio",
"command": "npx",
"args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
}
}
}
Available Tools
Once connected, these tools are available to your AI agent:
analyze_sequence
Submit a peptide sequence for analysis by the PEPTOMA AI Engine.
Inputs:
| Parameter | Type | Required | Description |
|---|---|---|---|
sequence |
string | Yes | Single-letter amino acid code or FASTA format (3–512 residues) |
depth |
"standard" | "deep" |
No | Analysis depth (default: "standard") |
diseaseTarget |
string | No | Disease or organism context (e.g. "MRSA", "Cancer") |
userId |
string | No | Solana wallet address for on-chain attribution |
notes |
string | No | Research notes |
Returns: Full SequenceAnalysis object with bioactivity score, label, structure, toxicity, MW, hydrophobicity, charge, half-life, confidence, and annotation suggestions.
get_analysis
Retrieve a previous analysis by ID.
Inputs: id (number)
search_feed
Search the open PEPTOMA research feed.
Inputs:
| Parameter | Type | Description |
|---|---|---|
disease |
string | Filter by disease target |
minScore |
number | Minimum bioactivity score (0–100) |
sort |
"newest" | "score" | "annotations" | "trending" |
Sort order |
limit |
number | Results per page (default: 20) |
page |
number | Page number (default: 1) |
get_feed_stats
Platform-wide statistics: total analyses, average scores, annotation counts, disease breakdown.
get_trending
Top 10 sequences ranked by community vote count.
list_annotations
List all peer-review annotations for a sequence.
Inputs: sequenceId (number)
create_annotation
Submit a peer-review annotation and earn $PEPTM.
Inputs:
| Parameter | Type | Required | Description |
|---|---|---|---|
sequenceId |
number | Yes | Target sequence ID |
userId |
string | Yes | Your wallet address (for token rewards) |
type |
"confirm" | "challenge" | "extend" | "tag" |
Yes | Annotation type |
content |
string | No | Your scientific reasoning or evidence |
Reward rates: confirm +2, challenge +3, extend +5, tag +2 $PEPTM
vote_annotation
Upvote or downvote an annotation.
Inputs: annotationId (number), direction ("up" | "down")
get_token_balance
Get $PEPTM balance and staking info for a user.
Inputs: userId (string — Solana wallet address)
get_leaderboard
Top contributors ranked by total $PEPTM earned.
Example Agent Sessions
Screening antimicrobial candidates:
You: Screen these sequences for MRSA activity and flag anything above 80 with low toxicity:
KWLRRVWRPQKI, FLPLIGRVLSGIL, GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK
Agent:
→ analyze_sequence("KWLRRVWRPQKI", disease: "MRSA") → score: 91, toxic: low ✓
→ analyze_sequence("FLPLIGRVLSGIL", disease: "MRSA") → score: 67, toxic: medium ✗
→ analyze_sequence("GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK", disease: "MRSA") → score: 88, toxic: low ✓
2 candidates passed: #1 and #3. Submitting confirmation annotations...
→ create_annotation(sequenceId: 1, type: "confirm", content: "High AMP score, low toxicity...")
→ create_annotation(sequenceId: 3, type: "confirm", content: "Defensin-class AMP candidate...")
Researching what's in the feed:
You: What are the top cancer peptides on PEPTOMA right now?
Agent:
→ search_feed({ disease: "Cancer", sort: "score", limit: 10 })
Returns ranked list with bioactivity scores, structure types, and annotation counts.
Building a research report:
You: Give me a summary of the PEPTOMA platform activity today
Agent:
→ get_feed_stats() → totalAnalyses: 1,247, recentActivity: 34, avgScore: 71.4
→ get_trending() → top 10 sequences with community vote counts
→ get_leaderboard() → top 5 contributors this period
CLI Options
peptoma-mcp [options]
Options:
--api-key <key> Your PEPTOMA API key (pptm_...)
--base-url <url> Override API base URL (default: https://peptoma.xyz/api)
--help Show help
Environment Variables
| Variable | Description |
|---|---|
PEPTOMA_API_KEY |
Your PEPTOMA API key — alternative to --api-key flag |
PEPTOMA_BASE_URL |
Override API base URL |
Links
| Resource | URL |
|---|---|
| Platform | peptoma.xyz |
| Docs | peptoma.xyz/docs |
| npm (SDK) | npmjs.com/package/peptoma-sdk |
| npm (MCP) | npmjs.com/package/peptoma-mcp |
| Token CA | HopMHHPfSV2kWQLghKt6xR1oWbPRLA2UyxnKGoPpump |
License
MIT © 2026 PEPTOMA Team
Recommended Servers
playwright-mcp
A Model Context Protocol server that enables LLMs to interact with web pages through structured accessibility snapshots without requiring vision models or screenshots.
Magic Component Platform (MCP)
An AI-powered tool that generates modern UI components from natural language descriptions, integrating with popular IDEs to streamline UI development workflow.
Audiense Insights MCP Server
Enables interaction with Audiense Insights accounts via the Model Context Protocol, facilitating the extraction and analysis of marketing insights and audience data including demographics, behavior, and influencer engagement.
VeyraX MCP
Single MCP tool to connect all your favorite tools: Gmail, Calendar and 40 more.
graphlit-mcp-server
The Model Context Protocol (MCP) Server enables integration between MCP clients and the Graphlit service. Ingest anything from Slack to Gmail to podcast feeds, in addition to web crawling, into a Graphlit project - and then retrieve relevant contents from the MCP client.
Kagi MCP Server
An MCP server that integrates Kagi search capabilities with Claude AI, enabling Claude to perform real-time web searches when answering questions that require up-to-date information.
E2B
Using MCP to run code via e2b.
Neon Database
MCP server for interacting with Neon Management API and databases
Exa Search
A Model Context Protocol (MCP) server lets AI assistants like Claude use the Exa AI Search API for web searches. This setup allows AI models to get real-time web information in a safe and controlled way.
Qdrant Server
This repository is an example of how to create a MCP server for Qdrant, a vector search engine.